Structure of PDB 6y79 Chain M |
>6y79M (length=117) Species: 4952 (Yarrowia lipolytica) [Search protein sequence] |
KSIISYNGNTIEIPEEYTKQAPNRDSTWAPAQASKTEIYKNNMVRFEQKD LSKQPMPYAGIELIAQQPVRFVHGNTAVCDGANHNGPGAQGHPKIFINVD APGSHACQYCGTRYEKE |
|
PDB | 6y79 Essential role of accessory subunit LYRM6 in the mechanism of mitochondrial complex I. |
Chain | M |
Resolution | 2.96 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C97 H110 C125 C128 |
C79 H92 C107 C110 |
|
|
|
|