Structure of PDB 6v8s Chain M

Receptor sequence

>6v8sM (length=152) Species: 3818 (Arachis hypogaea) [Search protein sequence]

GVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPG
TVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFK
TKLEAADGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVL
SN

3D structure

PDB

6v8s Crystal structure of Ara h 8.0201

Chain

Resolution

2.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	2AN	M	G148 Y149 S152 N153	G147 Y148 S151 N152
BS02	2AN	M	Q92 E93 I94	Q91 E92 I93
BS03	2AN	M	G123 D124 A125	G122 D123 A124
BS04	2AN	M	F100 V115 V117 K136 S139 Q140 F143	F99 V114 V116 K135 S138 Q139 F142
BS05	2AN	M	A58 S65 Y66 V67 I85 F91 K138 I142	A57 S64 Y65 V66 I84 F90 K137 I141
BS06	2AN	M	A37 E60 K138 I142	A36 E59 K137 I141
BS07	2AN	M	Y66 S86 G88	Y65 S85 G87
BS08	2AN	M	E42 V44 K55 Y66	E41 V43 K54 Y65

Gene Ontology

	Molecular Function
GO:0004864	protein phosphatase inhibitor activity
GO:0010427	abscisic acid binding
GO:0038023	signaling receptor activity

	Biological Process
GO:0006952	defense response
GO:0009738	abscisic acid-activated signaling pathway

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6v8s, PDBe:6v8s, PDBj:6v8s
PDBsum	6v8s
PubMed
UniProt	B0YIU5

[Back to BioLiP]