Structure of PDB 6snt Chain M

Receptor sequence
>6sntM (length=121) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEANII
KLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVGASVVV
VKNWGAETDELSMIMEHFSQQ
3D structure
PDB6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
ChainM
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M R43 G44 L45 R46 E47 T67 K114 A118 S119 R21 G22 L23 R24 E25 T45 K92 A96 S97
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6snt, PDBe:6snt, PDBj:6snt
PDBsum6snt
PubMed32203490
UniProtP48589|RS12_YEAST Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]