Structure of PDB 6s12 Chain M

Receptor sequence

>6s12M (length=119) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAEAARESGLEF

3D structure

PDB

6s12 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	M1 I2 R14 R17 L22 F94 R96 L100 Y101 R113	M1 I2 R14 R17 L22 F94 R96 L100 Y101 R113
BS02	rna	M	K4 K7 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 H39 Q43 I45 G50 V51 T52 Q55 K59 T68 K69 V70 H102 G103 R104	K4 K7 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 H39 Q43 I45 G50 V51 T52 Q55 K59 T68 K69 V70 H102 G103 R104

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links