Structure of PDB 6s0x Chain M

Receptor sequence
>6s0xM (length=118) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGV
TLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLY
HGRVKALAEAARESGLEF
3D structure
PDB6s0x Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.
ChainM
Resolution2.425 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M I2 R14 R17 F94 R96 Y101 R113 I1 R13 R16 F93 R95 Y100 R112
BS02 rna M K4 K7 K9 R11 R19 R30 N32 Y34 R35 S36 N37 K38 Q43 T52 K59 T68 V70 H102 G103 R104 K3 K6 K8 R10 R18 R29 N31 Y33 R34 S35 N36 K37 Q42 T51 K58 T67 V69 H101 G102 R103
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s0x, PDBe:6s0x, PDBj:6s0x
PDBsum6s0x
PubMed31391518
UniProtW8TRE0

[Back to BioLiP]