Structure of PDB 6r87 Chain M

Receptor sequence

>6r87M (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

6r87 Structure and function of Vms1 and Arb1 in RQC and mitochondrial proteome homeostasis.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	R10 Q43 T44 V69 T70 R72 G135 R137 R141 R143 G149 N150 H152	R5 Q38 T39 V64 T65 R67 G130 R132 R136 R138 G144 N145 H147
BS02	rna	M	N20 S22 S48 A50 R51 Y52 F57 H68 R94 N95 F96 S97 A98 T99 F104 G105 I106 G124 M125 D126 Y128 K142	N15 S17 S43 A45 R46 Y47 F52 H63 R89 N90 F91 S92 A93 T94 F99 G100 I101 G119 M120 D121 Y123 K137

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6r87, PDBe:6r87, PDBj:6r87
PDBsum	6r87
PubMed	31189955
UniProt	Q3E757\|RL11B_YEAST Large ribosomal subunit protein uL5B (Gene Name=RPL11B)

[Back to BioLiP]