Structure of PDB 6psq Chain M

Receptor sequence

>6psqM (length=73) Species: 562 (Escherichia coli) [Search protein sequence]

DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKS
LTEIKDVLASRGLSLGMRLENWP

3D structure

PDB

6psq Stepwise Promoter Melting by Bacterial RNA Polymerase.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	M	R265 N294 L295 G296 K298	R16 N45 L46 G47 K49

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0005515	protein binding
GO:0016779	nucleotidyltransferase activity
GO:0034062	5'-3' RNA polymerase activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006352	DNA-templated transcription initiation
GO:0006879	intracellular iron ion homeostasis
GO:0009408	response to heat
GO:0031564	transcription antitermination
GO:0032784	regulation of DNA-templated transcription elongation
GO:0036460	cellular response to cell envelope stress
GO:0042128	nitrate assimilation
GO:0044780	bacterial-type flagellum assembly
GO:0048870	cell motility
GO:0071973	bacterial-type flagellum-dependent cell motility
GO:0090605	submerged biofilm formation
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0000345	cytosolic DNA-directed RNA polymerase complex
GO:0000428	DNA-directed RNA polymerase complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0008023	transcription elongation factor complex
GO:0016020	membrane

External links

PDB	RCSB:6psq, PDBe:6psq, PDBj:6psq
PDBsum	6psq
PubMed	32160514
UniProt	P0A7Z4\|RPOA_ECOLI DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)