Structure of PDB 6o90 Chain M

Receptor sequence

>6o90M (length=145) Species: 1351 (Enterococcus faecalis)

MKLHLKPAEGSRQVRNRVGRGTSSGNGKTAGRGQKGQKARSGGGVRLGFE
GGQTPLFRRLPKRGFTNINRKDYAVVNLDTLNRFEDGTEVTPVVLKEAGI
VKNEKAGIKVLADGELTKKLTVKAAKFSKSAQEAIEAAGGSIEVI

3D structure

• PDB: 6o90 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
• Chain: M
• Resolution: 3.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	L3 H4 L6 R13 Q14 R16 R18 G20 R21 G22 S24 S25 K29 T30 A31 G32 R33 Q35 K36 Q38 K39 R41 S42 G43 F50 G53 Q54 T55 F58 R59 R60 P62 K63 R64 F66 N68 I69 R71 N78 K103 K110 L112 A113 K130	L3 H4 L5 R12 Q13 R15 R17 G19 R20 G21 S23 S24 K28 T29 A30 G31 R32 Q34 K35 Q37 K38 R40 S41 G42 F49 G52 Q53 T54 F57 R58 R59 P61 K62 R63 F65 N67 I68 R70 N77 K102 K109 L111 A112 K129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6o90, PDBe:6o90, PDBj:6o90
• PDBsum: 6o90
• PubMed: 33004869
• UniProt: A0A1B4XKT1