Structure of PDB 6o1m Chain M

Receptor sequence

>6o1mM (length=67) Species: 208964 (Pseudomonas aeruginosa PAO1)

HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPSRPVRLP

3D structure

• PDB: 6o1m Architectural principles for Hfq/Crc-mediated regulation of gene expression.
• Chain: M
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	Y25 I30 K31 L32 N48 Q52 T61	Y21 I26 K27 L28 N44 Q48 T57

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:6o1m, PDBe:6o1m, PDBj:6o1m
• PDBsum: 6o1m
• PubMed: 30758287
• UniProt: Q9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)