Structure of PDB 6lkq Chain M

Receptor sequence
>6lkqM (length=96) Species: 562 (Escherichia coli) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNARWNAVLKLQTLPRDS
SPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB6lkq The structural basis for inhibition of ribosomal translocation by viomycin.
ChainM
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M A1 K2 Q3 S4 M5 R8 R12 F20 R23 K27 Q48 R52 S55 P56 S57 R58 R60 N61 R62 R68 H70 F72 L73 R74 R80 K97 S99 W100 A1 K2 Q3 S4 M5 R8 R12 F20 R23 K27 Q44 R48 S51 P52 S53 R54 R56 N57 R58 R64 H66 F68 L69 R70 R76 K93 S95 W96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lkq, PDBe:6lkq, PDBj:6lkq
PDBsum6lkq
PubMed32341159
UniProtA0A090BZT4

[Back to BioLiP]