Structure of PDB 6j4w Chain M |
>6j4wM (length=64) Species: 644223 (Komagataella phaffii GS115) [Search protein sequence] |
IKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCNLSFQAPINSLS QPIDIYSDWIDACE |
|
PDB | 6j4w Structural insight into nucleosome transcription by RNA polymerase II with elongation factors. |
Chain | M |
Resolution | 7.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C25 C49 L54 |
C11 C35 L40 |
|
|
|
|