Structure of PDB 6id0 Chain M

Receptor sequence
>6id0M (length=130) Species: 9606 (Homo sapiens) [Search protein sequence]
KKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPT
SNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINE
RNAKFNKKAERFYGKYTAEIKQNLERGTAV
3D structure
PDB6id0 Structures of the human spliceosomes before and after release of the ligated exon.
ChainM
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M N119 P120 D121 Y127 A130 R133 Q134 K192 R193 Y196 R214 N6 P7 D8 Y14 A17 R20 Q21 K79 R80 Y83 R101
BS02 rna M K114 Y196 S197 R198 R200 R214 K217 F218 K221 R224 K1 Y83 S84 R85 R87 R101 K104 F105 K108 R111
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0001701 in utero embryonic development
GO:0006397 mRNA processing
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0007369 gastrulation
GO:0008284 positive regulation of cell population proliferation
GO:0008380 RNA splicing
GO:0048568 embryonic organ development
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6id0, PDBe:6id0, PDBj:6id0
PDBsum6id0
PubMed30728453
UniProtO95926|SYF2_HUMAN Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)

[Back to BioLiP]