Structure of PDB 6hd7 Chain M

Receptor sequence

>6hd7M (length=169) Species: 4932 (Saccharomyces cerevisiae)

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

• PDB: 6hd7 Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
• Chain: M
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	N20 S22 A50 R51 Y52 V54 T56 F57 I65 A66 R94 N95 F96 S97 T99 G103 F104 G105 I106 D107 G124 M125 D126 Y128 K142	N15 S17 A45 R46 Y47 V49 T51 F52 I60 A61 R89 N90 F91 S92 T94 G98 F99 G100 I101 D102 G119 M120 D121 Y123 K137
BS02	rna	M	R10 Q43 T44 V69 T70 R72 P134 R137 R140 R141 R143 T147 G149 N150 H152	R5 Q38 T39 V64 T65 R67 P129 R132 R135 R136 R138 T142 G144 N145 H147
BS03	rna	M	T53 R55	T48 R50

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hd7, PDBe:6hd7, PDBj:6hd7
• PDBsum: 6hd7
• PubMed: 30559462
• UniProt: P0C0W9|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)