Structure of PDB 6gyl Chain M

Receptor sequence
>6gylM (length=279) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
PNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRT
FNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAK
ITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRR
AEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSQNLTYIPRFCSHLG
LPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAK
VGQTLQVTEGTIKSGYKILYEHRDKLVDP
3D structure
PDB6gyl Promoter Distortion and Opening in the RNA Polymerase II Cleft.
ChainM
Resolution4.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna M S167 K201 S135 K169
BS02 dna M K164 G271 K272 S273 T276 T305 T308 K132 G224 K225 S226 T229 T258 T261
BS03 ZN M C24 C45 C9 C30
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001139 RNA polymerase II complex recruiting activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006352 DNA-templated transcription initiation
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0010467 gene expression
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070897 transcription preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gyl, PDBe:6gyl, PDBj:6gyl
PDBsum6gyl
PubMed30472190
UniProtP29055|TF2B_YEAST Transcription initiation factor IIB (Gene Name=SUA7)

[Back to BioLiP]