Structure of PDB 6et5 Chain M

Receptor sequence

>6et5M (length=323) Species: 1079 (Blastochloris viridis)

ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIY
LGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQY
GMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAA
AIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWH
GFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFW
RWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHG
AAPDYPAYLPATPDPASLPGAPK

3D structure

• PDB: 6et5 Cryo-EM structure of the Blastochloris viridis LH1-RC complex at 2.9 angstrom.
• Chain: M
• Resolution: 2.87 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCB	M	I204 Y208	I204 Y208
BS02	BPB	M	Y208 L212 W250	Y208 L212 W250
BS03	FE	M	H217 E232 H264	H217 E232 H264
BS04	BCB	M	I177 H180 I181 L184	I177 H180 I181 L184
BS05	BCB	M	F154 V155 L184 S188 F194 Y195 H200 I204 M275 A278 I282	F154 V155 L184 S188 F194 Y195 H200 I204 M275 A278 I282
BS06	BPB	M	I66 W127 F148 M275	I66 W127 F148 M275
BS07	MQ9	M	L213 H217 T220 W250 I254 N257 A258 V263	L213 H217 T220 W250 I254 N257 A258 V263
BS08	NS5	M	G117 M120 T121 G159 C160 F175 G176 H180	G117 M120 T121 G159 C160 F175 G176 H180

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:6et5, PDBe:6et5, PDBj:6et5
• PDBsum: 6et5
• PubMed: 29618818
• UniProt: P06010|RCEM_BLAVI Reaction center protein M chain (Gene Name=pufM)