Structure of PDB 6es3 Chain M

Receptor sequence
>6es3M (length=72) Species: 9606 (Homo sapiens) [Search protein sequence]
RTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIW
FQNRRAKERKINKKKLQQQQQQ
3D structure
PDB6es3 Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
ChainM
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna M T185 R190 V191 Y193 R198 R228 Q229 N236 K240 T2 R7 V8 Y10 R15 R45 Q46 N53 K57 PDBbind-CN: Kd=31.5nM
BS02 dna M Y189 R190 V192 I213 K216 Q235 R238 R242 Y6 R7 V9 I30 K33 Q52 R55 R59 PDBbind-CN: Kd=31.5nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6es3, PDBe:6es3, PDBj:6es3
PDBsum6es3
PubMed29638214
UniProtQ99626|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]