Structure of PDB 6bok Chain M

Receptor sequence

>6bokM (length=150) Species: 262724 (Thermus thermophilus HB27)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 6bok Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: M
• Resolution: 3.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	S4 R7 N9 A12 N13 K14 R16 K17 R18 G20 R21 G22 P23 G24 G28 K29 T30 T32 R33 H35 K36 G37 Q38 K39 S40 R41 S42 G43 L45 K46 P48 R49 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 R77 Q81 N84 K86 D87 G104 L105 K107 K108 K113 L115 G116 E117 S131 K132 S133	S4 R7 N9 A12 N13 K14 R16 K17 R18 G20 R21 G22 P23 G24 G28 K29 T30 T32 R33 H35 K36 G37 Q38 K39 S40 R41 S42 G43 L45 K46 P48 R49 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 R77 Q81 N84 K86 D87 G104 L105 K107 K108 K113 L115 G116 E117 S131 K132 S133
BS02	rna	M	K139 A140	K139 A140
BS03	MG	M	N9 P10	N9 P10
BS04	MG	M	R18 V19	R18 V19

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bok, PDBe:6bok, PDBj:6bok
• PDBsum: 6bok
• PubMed: 29731232
• UniProt: Q72I23|RL15_THET2 Large ribosomal subunit protein uL15 (Gene Name=rplO)