Structure of PDB 6az3 Chain M

Receptor sequence

>6az3M (length=203) Species: 5661 (Leishmania donovani) [Search protein sequence]

GAFMYLNELWKKKSSDVMRFIQRIRSWEFRHQHTVVRLRRPTRPEKARML
GYKTKQGFCVFRVRVRRGGRKRPVHKGITYGKPKTSGVLGMKLNKNNQAV
AEQRLGKRFGNLRVLNSYWVNMDSTFKWYEVIAVDPMCKTIRRDPRINWI
VNSVHKHREQRGLTSAGRKHRGLRHKGHKASKLRPSYRAAWRRNNRIVFL
RKR

3D structure

PDB

6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	M	G2 F4 M5 K12 K14 S15 H34 T35 R40 R41 R44 K47 R49 M50 L51 K54 T55 K56 R67 R68 G69 G70 R71 K77 Y81 K83 P84 K85 T86 G91 M92 K93 L94 N95 K96 N97 N98 R105 K108 G111 N112 N117 W120 K140 T141 R147 W150 S154 V155 K157 H158 Q161 R162 L164 S166 R169 K170 H171 R172 R175 H176 K177 G178 H179 K180 K183 R185 P186 S187 Y188 R189 W192 R193 R194 N195 R197 V199 F200 L201 R202 R204	G1 F3 M4 K11 K13 S14 H33 T34 R39 R40 R43 K46 R48 M49 L50 K53 T54 K55 R66 R67 G68 G69 R70 K76 Y80 K82 P83 K84 T85 G90 M91 K92 L93 N94 K95 N96 N97 R104 K107 G110 N111 N116 W119 K139 T140 R146 W149 S153 V154 K156 H157 Q160 R161 L163 S165 R168 K169 H170 R171 R174 H175 K176 G177 H178 K179 K182 R184 P185 S186 Y187 R188 W191 R192 R193 N194 R196 V198 F199 L200 R201 R203
BS02	rna	M	R31 R67 G69 K72 P74 H76 K77 I79 T80 Y81 G82 V89 L90 K93 S125 T126	R30 R66 G68 K71 P73 H75 K76 I78 T79 Y80 G81 V88 L89 K92 S124 T125
BS03	rna	M	R38 Q57 F62 F110 N112 D136	R37 Q56 F61 F109 N111 D135

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6az3, PDBe:6az3, PDBj:6az3
PDBsum	6az3
PubMed	29150609
UniProt	E9BMB4

[Back to BioLiP]