Structure of PDB 5zeb Chain M

Receptor sequence

>5zebM (length=145) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

VIKLHDLKPAPGEKKAKTRVGRGEGSKGKTAGRGTKGTKARKNVPVMFEG
GQMPIHMRLPKLKGFKNRFRTEYQVVNVGDINKAFPQGGTVGVDELVAKG
LVRKNSLVKVLGDGKLTVKVDVTANKFSGSAREAITAAGGSATEL

3D structure

• PDB: 5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
• Chain: M
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	L6 H7 G14 E15 K16 K17 K19 T20 R21 V22 G23 R24 G25 G27 K29 K31 T32 A33 G34 R35 G36 T37 K38 T40 K41 R43 K44 N45 M49 F50 E51 G52 G53 Q54 M55 M59 R60 P62 K63 K65 G66 F67 K68 N69 R70 F71 R72 Q76 V77 N79 R105 K106 K111 L113 D115 S130 S132	L4 H5 G12 E13 K14 K15 K17 T18 R19 V20 G21 R22 G23 G25 K27 K29 T30 A31 G32 R33 G34 T35 K36 T38 K39 R41 K42 N43 M47 F48 E49 G50 G51 Q52 M53 M57 R58 P60 K61 K63 G64 F65 K66 N67 R68 F69 R70 Q74 V75 N77 R103 K104 K109 L111 D113 S128 S130

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
• PDBsum: 5zeb
• PubMed: 30206241
• UniProt: A0QSG8