Structure of PDB 5z58 Chain M

Receptor sequence
>5z58M (length=36) Species: 9606 (Homo sapiens) [Search protein sequence]
ATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDY
3D structure
PDB5z58 Structure of the human activated spliceosome in three conformational states.
ChainM
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M I201 C202 K203 F213 C217 F219 I11 C12 K13 F23 C27 F29
BS02 ZN M C202 C211 C217 H221 C12 C21 C27 H31
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006281 DNA repair
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0016567 protein ubiquitination
GO:0034247 snoRNA splicing
GO:0070100 negative regulation of chemokine-mediated signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z58, PDBe:5z58, PDBj:5z58
PDBsum5z58
PubMed29360106
UniProtO15541|R113A_HUMAN E3 ubiquitin-protein ligase RNF113A (Gene Name=RNF113A)

[Back to BioLiP]