Structure of PDB 5xog Chain M |
>5xogM (length=64) Species: 4922 (Komagataella pastoris) [Search protein sequence] |
IKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCGQRFQAPINSLS QPIDIYSDWIDACE |
|
PDB | 5xog Structure of the complete elongation complex of RNA polymerase II with basal factors |
Chain | M |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C25 C49 |
C11 C35 |
|
|
|