Structure of PDB 5x1b Chain M

Receptor sequence
>5x1bM (length=43) Species: 9913 (Bos taurus) [Search protein sequence]
ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS
3D structure
PDB5x1b A nanosecond time-resolved XFEL analysis of structural changes associated with CO release from cytochrome c oxidase.
ChainM
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DMU M L28 G31 W32 Y35 L28 G31 W32 Y35
Gene Ontology
Biological Process
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0045277 respiratory chain complex IV

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5x1b, PDBe:5x1b, PDBj:5x1b
PDBsum5x1b
PubMed28740863
UniProtP10175|COX8B_BOVIN Cytochrome c oxidase subunit 8B, mitochondrial (Gene Name=COX8B)

[Back to BioLiP]