Structure of PDB 5w1t Chain M |
>5w1tM (length=140) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
LSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRNQLRDEVDRTVTH MQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDF GYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG |
|
PDB | 5w1t Allosteric Effector ppGpp Potentiates the Inhibition of Transcript Initiation by DksA. |
Chain | M |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C114 C138 |
C103 C127 |
|
|
|
|