Structure of PDB 5v7q Chain M

Receptor sequence
>5v7qM (length=134) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
LIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESAR
IAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGR
VLFELSYPNEGVARAALTRAIHKLPIKARIITRE
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
ChainM
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M P4 R5 K8 H9 K11 Q12 H13 R16 S22 G23 G24 N28 Y41 R45 Q46 R56 W65 F69 D71 R72 T75 R82 M83 G84 G86 R101 R120 H123 K124 K128 P3 R4 K7 H8 K10 Q11 H12 R15 S21 G22 G23 N27 Y40 R44 Q45 R55 W64 F68 D70 R71 T74 R81 M82 G83 G85 R100 R119 H122 K123 K127
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WHD5|RL16_MYCTU Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]