Structure of PDB 5v33 Chain M

Receptor sequence

>5v33M (length=302) Species: 1063 (Cereibacter sphaeroides)

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

• PDB: 5v33 X-ray transparent microfluidic chips for high-throughput screening and optimization of in meso membrane protein crystallization.
• Chain: M
• Resolution: 3.487 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	M	Y210 L214 M218	Y210 L214 M218
BS02	BCL	M	I206 A207 Y210 L214	I206 A207 Y210 L214
BS03	FE	M	H219 E234 H266	H219 E234 H266
BS04	U10	M	M218 H219 W252 M256 N259 A260 I265 W268	M218 H219 W252 M256 N259 A260 I265 W268
BS05	BCL	M	A153 L156 W157 T186 F197 H202 S205 I206 L209 Y210 G280 I284	A153 L156 W157 T186 F197 H202 S205 I206 L209 Y210 G280 I284
BS06	BPH	M	F67 W129 A149 F150 A153 A273 T277	F67 W129 A149 F150 A153 A273 T277

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:5v33, PDBe:5v33, PDBj:5v33
• PDBsum: 5v33
• PubMed: 28469762
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)