Structure of PDB 5sva Chain M |
>5svaM (length=156) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQR DPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNN SGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLE SLYDLI |
|
PDB | 5sva Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex. |
Chain | M |
Resolution | 15.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
M |
E8 L9 Q10 |
E8 L9 Q10 |
|
|
|
Biological Process |
GO:0006357 |
regulation of transcription by RNA polymerase II |
GO:0032968 |
positive regulation of transcription elongation by RNA polymerase II |
GO:0045944 |
positive regulation of transcription by RNA polymerase II |
GO:0051123 |
RNA polymerase II preinitiation complex assembly |
GO:0060261 |
positive regulation of transcription initiation by RNA polymerase II |
|
|