Structure of PDB 5nfy Chain M |
>5nfyM (length=132) Species: 229992 (SARS coronavirus Frankfurt 1) [Search protein sequence] |
HAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHT GTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQI PTTCANDPVGFTLRNTVCTVCGMWKGYGCSCD |
|
PDB | 5nfy Structural and molecular basis of mismatch correction and ribavirin excision from coronavirus RNA. |
Chain | M |
Resolution | 3.382 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C74 C77 H83 C90 |
C75 C78 H84 C91 |
|
|
|
|