Structure of PDB 5mps Chain M

Receptor sequence

>5mpsM (length=252) Species: 4932 (Saccharomyces cerevisiae)

SWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFA
LQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKL
ALRTEVLDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKHLK
PAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQ
TLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQEELKLESLNMMVH
LI

3D structure

• PDB: 5mps Structure of a spliceosome remodelled for exon ligation.
• Chain: M
• Resolution: 3.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	N44 Y138 G140 G141 D143 R174 K179 F183 L222 W225 A226 N227 D229 P230 D231	N42 Y136 G138 G139 D141 R172 K177 F181 L220 W223 A224 N225 D227 P228 D229
BS02	rna	M	P19 N31 Y34 K36 S38 Q39 R46 F47 S49 L74 F75 M80 C81 C82 Y89 F117 D119 R121 G125 G126 I127 K196 S200 N201 L222 V223	P17 N29 Y32 K34 S36 Q37 R44 F45 S47 L72 F73 M78 C79 C80 Y87 F115 D117 R119 G123 G124 I125 K194 S198 N199 L220 V221
BS03	ZN	M	C73 C81 C87 H91	C71 C79 C85 H89

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0017070 U6 snRNA binding
• GO:0036002 pre-mRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000387 spliceosomal snRNP assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0033120 positive regulation of RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome
• GO:0045787 positive regulation of cell cycle

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:5mps, PDBe:5mps, PDBj:5mps
• PDBsum: 5mps
• PubMed: 28076345
• UniProt: Q12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 (Gene Name=CWC2)