Structure of PDB 5lzt Chain M

Receptor sequence

>5lztM (length=138) Species: 9986 (Oryctolagus cuniculus)

VFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTRVRRQAMP
FKCMQLTDFILKFPHSARQKYVRKAWEKADINTKWAATRWAKKIEARERK
AKMTDFDRYKVMKAKKMRNRIIKNEVKKLQRAALLKAS

3D structure

• PDB: 5lzt Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
• Chain: M
• Resolution: 3.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	F3 R5 F17 P19 H20 K23 D29 N34 R44 V45 R46 Q48 K53 Q56 P65 H66 R69 Q70 K71 Y72 R74 R90 W91 K94 R98 K101 M113 K114 K116 K117 M118 N120 R121 R132	F2 R4 F16 P18 H19 K22 D28 N33 R43 V44 R45 Q47 K52 Q55 P64 H65 R68 Q69 K70 Y71 R73 R89 W90 K93 R97 K100 M112 K113 K115 K116 M117 N119 R120 R131

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5lzt, PDBe:5lzt, PDBj:5lzt
• PDBsum: 5lzt
• PubMed: 27863242
• UniProt: G1SZ12|RL14_RABIT Large ribosomal subunit protein eL14 (Gene Name=RPL14)