Structure of PDB 5lse Chain M

Receptor sequence

>5lseM (length=300) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYL
GSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYG
LSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLS
AIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPFH
GLSIAFLYGSALAFAMHGATILAVSRFGGERELEQIADRGTAAERAALFW
RWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNHG

3D structure

PDB

5lse On the mechanism of ubiquinone mediated photocurrent generation by a reaction center based photocathode.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	I206 A207 Y210 L214	I204 A205 Y208 L212
BS02	BPH	M	Y210 L214 W252	Y208 L212 W250
BS03	FE	M	H219 E234 H266	H217 E232 H264
BS04	BCL	M	H182 L183	H180 L181
BS05	BCL	M	L156 W157 T186 N187 F189 L196 F197 H202 S205 I206 L209 Y210 V276 G280 I284	L154 W155 T184 N185 F187 L194 F195 H200 S203 I204 L207 Y208 V274 G278 I282
BS06	BPH	M	G63 F67 A125 V126 W129 A149 F150 A153 T277	G61 F65 A123 V124 W127 A147 F148 A151 T275
BS07	U10	M	L214 M218 H219 T222 A248 A249 W252 M256 N259 A260 T261 I265 W268	L212 M216 H217 T220 A246 A247 W250 M254 N257 A258 T259 I263 W266
BS08	SPN	M	F67 F68 I70 G71 W75 W115 S119 M122 W157 G161 V175 H182	F65 F66 I68 G69 W73 W113 S117 M120 W155 G159 V173 H180

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lse, PDBe:5lse, PDBj:5lse
PDBsum	5lse
PubMed	27687473
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]