Structure of PDB 5iy8 Chain M

Receptor sequence
>5iy8M (length=310) Species: 9606 (Homo sapiens) [Search protein sequence]
LDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFS
NDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRT
MSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRAN
DAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSV
DLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAA
AIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKF
DTPVDKLPQL
3D structure
PDB5iy8 Near-atomic resolution visualization of human transcription promoter opening.
ChainM
Resolution7.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna M K86 K152 K189 K196 R286 R290 K80 K146 K183 K190 R280 R284
BS02 dna M F55 S56 N57 N72 N103 R104 T106 M107 R112 K119 R154 K178 R193 V280 A281 T284 F49 S50 N51 N66 N97 R98 T100 M101 R106 K113 R148 K172 R187 V274 A275 T278
BS03 ZN M H18 C34 H12 C28
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993 RNA polymerase II complex binding
GO:0003677 DNA binding
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0016407 acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
GO:0046966 nuclear thyroid hormone receptor binding
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0140297 DNA-binding transcription factor binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006338 chromatin remodeling
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006473 protein acetylation
GO:0010467 gene expression
GO:0019083 viral transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0051177 meiotic sister chromatid cohesion
GO:0051225 spindle assembly
GO:0051276 chromosome organization
GO:0070897 transcription preinitiation complex assembly
GO:1904798 positive regulation of core promoter binding
GO:1990114 RNA polymerase II core complex assembly
Cellular Component
GO:0000776 kinetochore
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005694 chromosome
GO:0016604 nuclear body
GO:0032153 cell division site
GO:0032993 protein-DNA complex
GO:0042585 germinal vesicle
GO:0090575 RNA polymerase II transcription regulator complex
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5iy8, PDBe:5iy8, PDBj:5iy8
PDBsum5iy8
PubMed27193682
UniProtQ00403|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]