Structure of PDB 5iy8 Chain M

Receptor sequence

>5iy8M (length=310) Species: 9606 (Homo sapiens) [Search protein sequence]

LDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFS
NDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRT
MSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRAN
DAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSV
DLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAA
AIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKF
DTPVDKLPQL

3D structure

PDB

5iy8 Near-atomic resolution visualization of human transcription promoter opening.

Chain

Resolution

7.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	M	K86 K152 K189 K196 R286 R290	K80 K146 K183 K190 R280 R284
BS02	dna	M	F55 S56 N57 N72 N103 R104 T106 M107 R112 K119 R154 K178 R193 V280 A281 T284	F49 S50 N51 N66 N97 R98 T100 M101 R106 K113 R148 K172 R187 V274 A275 T278
BS03	ZN	M	H18 C34	H12 C28

Gene Ontology

	Molecular Function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993	RNA polymerase II complex binding
GO:0003677	DNA binding
GO:0004402	histone acetyltransferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0016407	acetyltransferase activity
GO:0016746	acyltransferase activity
GO:0017025	TBP-class protein binding
GO:0046872	metal ion binding
GO:0046966	nuclear thyroid hormone receptor binding
GO:0061733	peptide-lysine-N-acetyltransferase activity
GO:0140297	DNA-binding transcription factor binding
GO:1990841	promoter-specific chromatin binding

	Biological Process
GO:0001174	transcriptional start site selection at RNA polymerase II promoter
GO:0006338	chromatin remodeling
GO:0006352	DNA-templated transcription initiation
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006473	protein acetylation
GO:0010467	gene expression
GO:0019083	viral transcription
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0051177	meiotic sister chromatid cohesion
GO:0051225	spindle assembly
GO:0051276	chromosome organization
GO:0070897	transcription preinitiation complex assembly
GO:1904798	positive regulation of core promoter binding
GO:1990114	RNA polymerase II core complex assembly

	Cellular Component
GO:0000776	kinetochore
GO:0000793	condensed chromosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005669	transcription factor TFIID complex
GO:0005694	chromosome
GO:0016604	nuclear body
GO:0032153	cell division site
GO:0032993	protein-DNA complex
GO:0042585	germinal vesicle
GO:0090575	RNA polymerase II transcription regulator complex
GO:0097550	transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5iy8, PDBe:5iy8, PDBj:5iy8
PDBsum	5iy8
PubMed	27193682
UniProt	Q00403\|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]