Structure of PDB 5ejd Chain M |
>5ejdM (length=70) Species: 36650 (Penicillium aethiopicum) [Search protein sequence] |
LSTDAERELANIWATVLDIPIGTISASDNFFFRGGHSIDAMKASALGRAA GMSFGVADIFDHPVLSELAS |
|
PDB | 5ejd Structural basis of nonribosomal peptide macrocyclization in fungi |
Chain | M |
Resolution | 2.49 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5PD |
M |
S40 I41 |
S37 I38 |
|
|
|