Structure of PDB 4v4j Chain M

Receptor sequence
>4v4jM (length=106) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
YERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLAL
KLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAR
EGGLEF
3D structure
PDB4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
ChainM
Resolution3.83 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M Y7 E8 R9 K11 V14 R15 R20 T21 K93 Y94 F112 Y1 E2 R3 K5 V8 R9 R14 T15 K87 Y88 F106
BS02 rna M R17 F29 S31 H34 Q38 I40 V46 T47 L48 V49 S50 N61 K62 R89 K93 H95 G96 R97 R11 F23 S25 H28 Q32 I34 V40 T41 L42 V43 S44 N55 K56 R83 K87 H89 G90 R91
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
PDBsum4v4j
PubMed17940016
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]