Structure of PDB 4v1o Chain M

Receptor sequence
>4v1oM (length=299) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
LTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDH
NGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVKDN
EVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAA
SILIGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNIAQNLTYIPRFC
SHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPI
TAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGV
3D structure
PDB4v1o Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
ChainM
Resolution9.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna M K201 Y313 K314 G341 V342 K177 Y270 K271 G298 V299
BS02 dna M R64 N68 D69 G271 K272 S273 R43 N47 D48 G228 K229 S230
BS03 ZN M C24 C27 C45 C48 C3 C6 C24 C27
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001139 RNA polymerase II complex recruiting activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006352 DNA-templated transcription initiation
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0010467 gene expression
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070897 transcription preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v1o, PDBe:4v1o, PDBj:4v1o
PDBsum4v1o
PubMed25652824
UniProtP29055|TF2B_YEAST Transcription initiation factor IIB (Gene Name=SUA7)

[Back to BioLiP]