Structure of PDB 4tqq Chain M

Receptor sequence

>4tqqM (length=302) Species: 1063 (Cereibacter sphaeroides)

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

• PDB: 4tqq X-ray Transparent Microfluidic Chip for Mesophase-Based Crystallization of Membrane Proteins and On-Chip Structure Determination.
• Chain: M
• Resolution: 2.499 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BPH	M	Y210 L214 W252	Y210 L214 W252
BS02	BCL	M	G203 I206 A207 Y210 L214	G203 I206 A207 Y210 L214
BS03	FE2	M	H219 E234 H266	H219 E234 H266
BS04	U10	M	M218 H219 T222 W252 M256 N259 A260 I265 W268	M218 H219 T222 W252 M256 N259 A260 I265 W268
BS05	BCL	M	L156 T186 N187 L196 F197 H202 S205 I206 L209 Y210 G280 I284	L156 T186 N187 L196 F197 H202 S205 I206 L209 Y210 G280 I284
BS06	BCL	M	H182 L183	H182 L183
BS07	BPH	M	W66 F67 A125 V126 W129 A149 F150 A153 A273 T277	W66 F67 A125 V126 W129 A149 F150 A153 A273 T277

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:4tqq, PDBe:4tqq, PDBj:4tqq
• PDBsum: 4tqq
• PubMed: 25285049
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)