Structure of PDB 4pjo Chain M

Receptor sequence
>4pjoM (length=53) Species: 9606 (Homo sapiens) [Search protein sequence]
PKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLID
KTT
3D structure
PDB4pjo ?
ChainM
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M K3 T14 H15 S17 S19 V20 E32 K2 T13 H14 S16 S18 V19 E31
BS02 rna M T11 Y12 T14 H24 G27 R28 T10 Y11 T13 H23 G26 R27
BS03 ZN M C6 C9 H24 H30 C5 C8 H23 H29
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005685 U1 snRNP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C (Gene Name=SNRPC)

[Back to BioLiP]