Structure of PDB 4ogr Chain M |
>4ogrM (length=49) Species: 11707 (Human immunodeficiency virus type 1 (HXB3 ISOLATE)) [Search protein sequence] |
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGR |
|
PDB | 4ogr AFF4 binding to Tat-P-TEFb indirectly stimulates TAR recognition of super elongation complexes at the HIV promoter. |
Chain | M |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
M |
C22 H33 C34 C37 |
C22 H33 C34 C37 |
|
|
|
|