Structure of PDB 4in6 Chain M

Receptor sequence

>4in6M (length=302) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSAALFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

PDB

4in6 Role of Rhodobacter sphaeroides Photosynthetic Reaction Center Residue M214 in the Composition, Absorbance Properties, and Conformations of HA and BA Cofactors.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y210 A214 W252	Y210 A214 W252
BS02	BCL	M	I206 A207 Y210	I206 A207 Y210
BS03	BCL	M	H182 L183	H182 L183
BS04	BCL	M	L156 T186 N187 S190 L196 F197 H202 S205 I206 Y210 V276 G280 I284	L156 T186 N187 S190 L196 F197 H202 S205 I206 Y210 V276 G280 I284
BS05	FE	M	H219 E234 H266	H219 E234 H266
BS06	BPH	M	L60 G63 V126 W129 A149 F150 A153 T277	L60 G63 V126 W129 A149 F150 A153 T277
BS07	U10	M	M218 H219 T222 A249 W252 M256 F258 N259 A260 T261 I265 W268	M218 H219 T222 A249 W252 M256 F258 N259 A260 T261 I265 W268
BS08	SPO	M	F67 I70 G71 S119 F120 M122 W157 G161 W171 V175 Y177 H182	F67 I70 G71 S119 F120 M122 W157 G161 W171 V175 Y177 H182

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4in6, PDBe:4in6, PDBj:4in6
PDBsum	4in6
PubMed	23480277
UniProt	Q3J1A6\|RCEM_CERS4 Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]