Structure of PDB 4hbh Chain M

Receptor sequence

>4hbhM (length=301) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

EYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIY
LGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEY
GLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFL
SAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPF
HGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALF
WRWTMGFNATMEGNHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNH
G

3D structure

PDB

4hbh Bacterial Photosynthetic Reaction Center from Rhodobacter sphaeroides

Chain

Resolution

2.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	G203 I206 A207 Y210 G211	G202 I205 A206 Y209 G210
BS02	BPH	M	Y210 L214 W252	Y209 L213 W251
BS03	BCL	M	L160 H182 L183	L159 H181 L182
BS04	FE	M	H219 E234 H266	H218 E233 H265
BS05	BCL	M	L156 W157 T186 S190 L196 F197 H202 S205 I206 Y210 V276 G280 I284	L155 W156 T185 S189 L195 F196 H201 S204 I205 Y209 V275 G279 I283
BS06	BPH	M	G63 V126 W129 A149 F150 A153 A273 T277	G62 V125 W128 A148 F149 A152 A272 T276
BS07	U10	M	M218 H219 T222 A249 W252 M256 N259 A260 N265 W268	M217 H218 T221 A248 W251 M255 N258 A259 N264 W267
BS08	SPO	M	F67 G71 W75 S119 W157 G161 F162 Y177 H182	F66 G70 W74 S118 W156 G160 F161 Y176 H181

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4hbh, PDBe:4hbh, PDBj:4hbh
PDBsum	4hbh
PubMed
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]