Structure of PDB 4h9l Chain M

Receptor sequence

>4h9lM (length=301) Species: 1063 (Cereibacter sphaeroides)

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGSHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
H

3D structure

• PDB: 4h9l Bacterial Photosynthetic Reaction Center from Rhodobacter sphaeroides
• Chain: M
• Resolution: 2.77 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	G203 I206 A207 Y210 L214	G203 I206 A207 Y210 L214
BS02	BPH	M	Y210 L214 W252	Y210 L214 W252
BS03	BCL	M	H182 L183	H182 L183
BS04	FE	M	H219 E234 H266	H219 E234 H266
BS05	BCL	M	L156 W157 T186 S190 L196 F197 H202 S205 I206 V276 G280 I284	L156 W157 T186 S190 L196 F197 H202 S205 I206 V276 G280 I284
BS06	BPH	M	V126 W129 A149 F150 A153 T277	V126 W129 A149 F150 A153 T277
BS07	U10	M	M218 H219 T222 A248 A249 W252 M256 N259 A260 W268	M218 H219 T222 A248 A249 W252 M256 N259 A260 W268
BS08	SPO	M	F67 I70 W75 M122 W157 G161 F162 H182	F67 I70 W75 M122 W157 G161 F162 H182

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:4h9l, PDBe:4h9l, PDBj:4h9l
• PDBsum: 4h9l
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)