Structure of PDB 4d18 Chain M

Receptor sequence
>4d18M (length=298) Species: 9606 (Homo sapiens) [Search protein sequence]
SIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGG
NLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIEN
AKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPT
RTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYA
LEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKL
EQSEAQLGRGSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINI
3D structure
PDB4d18 Crystal Structure of the Human Cop9 Signalosome
ChainM
Resolution4.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN M E104 H138 H140 D151 E81 H115 H117 D128
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008237 metallopeptidase activity
GO:0019784 deNEDDylase activity
GO:0019899 enzyme binding
GO:0035718 macrophage migration inhibitory factor binding
GO:0046872 metal ion binding
GO:0140492 metal-dependent deubiquitinase activity
Biological Process
GO:0000338 protein deneddylation
GO:0006412 translation
GO:0006413 translational initiation
GO:0006508 proteolysis
GO:0043066 negative regulation of apoptotic process
GO:0043687 post-translational protein modification
GO:0045116 protein neddylation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046328 regulation of JNK cascade
GO:0051091 positive regulation of DNA-binding transcription factor activity
GO:0051726 regulation of cell cycle
GO:1903894 regulation of IRE1-mediated unfolded protein response
GO:1990182 exosomal secretion
GO:2000434 regulation of protein neddylation
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005852 eukaryotic translation initiation factor 3 complex
GO:0008021 synaptic vesicle
GO:0008180 COP9 signalosome
GO:0031410 cytoplasmic vesicle
GO:0045202 synapse
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d18, PDBe:4d18, PDBj:4d18
PDBsum4d18
PubMed25043011
UniProtQ92905|CSN5_HUMAN COP9 signalosome complex subunit 5 (Gene Name=COPS5)

[Back to BioLiP]