Structure of PDB 4b3m Chain M

Receptor sequence

>4b3mM (length=125) Species: 300852 (Thermus thermophilus HB8)

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAPRK

3D structure

• PDB: 4b3m 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
• Chain: M
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	M	R13 V16 Y20 Y22 G23 I24 G25 A27 R28 R43 N76 Y86 R87 R90 H91 P96 V97 R98 Q100 R101 T102 R103 T104 N105 A106 R107 T108 R109 K110 R113 K114 T115 R124 K125	R13 V16 Y20 Y22 G23 I24 G25 A27 R28 R43 N76 Y86 R87 R90 H91 P96 V97 R98 Q100 R101 T102 R103 T104 N105 A106 R107 T108 R109 K110 R113 K114 T115 R124 K125
BS02	MG	M	T19 I21 I24	T19 I21 I24

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4b3m, PDBe:4b3m, PDBj:4b3m
• PDBsum: 4b3m
• PubMed: 24473108
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)