Structure of PDB 3zum Chain M

Receptor sequence

>3zumM (length=301) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
H

3D structure

PDB

3zum Mechanism of Recombination of the P(+)H(A)(-) Radical Pair in Mutant Rhodobacter Sphaeroides Reaction Centers with Modified Free Energy Gaps between P(+)B(A)(-) and P(+)H(A)(-).

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	M	G203 I206 A207 Y210 L214	G203 I206 A207 Y210 L214
BS02	BPH	M	Y210 L214 W252	Y210 L214 W252
BS03	BCL	M	H182 L183	H182 L183
BS04	BCL	M	L156 W157 T186 S190 L196 F197 H202 S205 I206 L209 Y210 V276 G280 I284	L156 W157 T186 S190 L196 F197 H202 S205 I206 L209 Y210 V276 G280 I284
BS05	FE	M	H219 E234 H266	H219 E234 H266
BS06	BPH	M	G63 V126 W129 A149 F150 A153	G63 V126 W129 A149 F150 A153
BS07	SPN	M	F67 I70 G71 W75 W115 S119 M122 W157 G161 W171 H182	F67 I70 G71 W75 W115 S119 M122 W157 G161 W171 H182
BS08	U10	M	M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 I265 W268	M218 H219 T222 A248 A249 W252 M256 F258 N259 A260 I265 W268

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3zum, PDBe:3zum, PDBj:3zum
PDBsum	3zum
PubMed	21970763
UniProt	P0C0Y9\|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)

[Back to BioLiP]