Structure of PDB 3zk2 Chain M

Receptor sequence

>3zk2M (length=89) Species: 851 (Fusobacterium nucleatum) [Search protein sequence]

MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEAR
GSIISTMILGQAVAESTGIYSLVIALILLYANPFLSKLG

3D structure

PDB

3zk2 A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif.

Chain

Resolution

2.63 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DMU	M	M1 C13	M1 C13

Gene Ontology

	Molecular Function
GO:0008289	lipid binding
GO:0015078	proton transmembrane transporter activity
GO:0042802	identical protein binding
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism

	Biological Process
GO:0006754	ATP biosynthetic process
GO:0015986	proton motive force-driven ATP synthesis
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0033177	proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)

External links

PDB	RCSB:3zk2, PDBe:3zk2, PDBj:3zk2
PDBsum	3zk2
PubMed	23824040
UniProt	Q8RGD7\|ATPL_FUSNN ATP synthase subunit c (Gene Name=atpE)