Structure of PDB 3wmm Chain M

Receptor sequence

>3wmmM (length=319) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]

PEYQNIFTAVQVRAPAYPGVPLPKGNLPRIGRPIFSYWLGKIGDAQIGPI
YLGLTGTLSIFFGLVAISIIGFNMLASVHWDVFQFLKHFFWLGLEPPPPQ
YGLRIPPLSEGGWWLMAGLFLTLSILLWWVRTYKRAEALGMSQHLSWAFA
AAIFFYLVLGFIRPVMMGSWAKAVPFGIFPHLDWTAAFSIRYGNLYYNPF
HMLSIAFLYGSALLFAMHGATILSVSRFGGDREIDQITHRGTAAERAALF
WRWTMGFNVTMESIHRWAWWCAVLTVITAGIGILLSGTVVDNWYLWAVKH
GMAPAYPEVVTAVNPYETA

3D structure

PDB

3wmm Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom

Chain

Resolution

3.008 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BPH	M	Y210 A213 L214 A217 M218 W252 M256	Y209 A212 L213 A216 M217 W251 M255
BS02	BCL	M	M203 I206 A207 Y210 G211	M202 I205 A206 Y209 G210
BS03	BCL	M	H182 L183	H181 L182
BS04	BCL	M	F156 T186 F189 S190 L196 Y197 H202 S205 I206 L209 Y210 A280 I284	F155 T185 F188 S189 L195 Y196 H201 S204 I205 L208 Y209 A279 I283
BS05	BPH	M	W129 L146 F150 A153 V277	W128 L145 F149 A152 V276
BS06	FE	M	H219 E234 H266	H218 E233 H265
BS07	MQ8	M	L215 M218 H219 W252 M256 F258 N259 V260 W268	L214 M217 H218 W251 M255 F257 N258 V259 W267
BS08	CRT	M	I71 G72 L116 L120 T123 L160 G161 F162 V175 P176 F177 G178 I179 H182	I70 G71 L115 L119 T122 L159 G160 F161 V174 P175 F176 G177 I178 H181
BS09	PGW	M	I31 R33 I35	I30 R32 I34

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3wmm, PDBe:3wmm, PDBj:3wmm
PDBsum	3wmm
PubMed	24670637
UniProt	A8ASG6

[Back to BioLiP]