Structure of PDB 3u32 Chain M |
>3u32M (length=75) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPM AILGFALSEATGLFCLMVSFLLLFG |
|
PDB | 3u32 Structure of the c(10) ring of the yeast mitochondrial ATP synthase in the open conformation. |
Chain | M |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DCW |
M |
E59 L63 |
E59 L63 |
|
|
|
|