Structure of PDB 3jah Chain M

Receptor sequence
>3jahM (length=138) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
VFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTRVRRQAMP
FKCMQLTDFILKFPHSARQKYVRKAWEKADINTKWAATRWAKKIEARERK
AKMTDFDRYKVMKAKKMRNRIIKNEVKKLQRAALLKAS
3D structure
PDB3jah Structural basis for stop codon recognition in eukaryotes.
ChainM
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna M F3 R4 R5 F17 H20 N34 R46 Q48 K53 Q56 P65 S67 R69 Y72 R90 W91 K94 R98 K101 M113 K114 K117 M118 N120 R121 F2 R3 R4 F16 H19 N33 R45 Q47 K52 Q55 P64 S66 R68 Y71 R89 W90 K93 R97 K100 M112 K113 K116 M117 N119 R120
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jah, PDBe:3jah, PDBj:3jah
PDBsum3jah
PubMed26245381
UniProtG1SZ12|RL14_RABIT Large ribosomal subunit protein eL14 (Gene Name=RPL14)

[Back to BioLiP]