Structure of PDB 3iiu Chain M

Receptor sequence

>3iiuM (length=151) Species: 2961 (Amphidinium carterae)

ADEIGDAAKKLGDASYAFAKEVDWNNGIFLQAPGKLQPLEALKAIDKMIV
MGAAADPKLLKAAAEAHHKAIGSVSGPNGVTSRADWDSVLAALGRVIASV
PENMVMDVYDSVSKITDPKVPAYMKSLVNGADAEKAYEGFLAFKDVVKKS
Q

3D structure

• PDB: 3iiu Identification of a single peridinin sensing Chl-a excitation in reconstituted PCP by crystallography and spectroscopy.
• Chain: M
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	M	F17 A62 H66 L92 F139	F18 A63 H67 L93 F140
BS02	PID	M	F17 W23 F28 P120 A121 M123 K124 E133 Y136	F18 W24 F29 P121 A122 M124 K125 E134 Y137
BS03	PID	M	I27 F28 V119 M123	I28 F29 V120 M124
BS04	PID	M	M47 M50 V104 V107 Y108	M48 M51 V105 V108 Y109
BS05	PID	M	W23 A69 I70 G78 V79 T80 W85 L92 I96 E101 V104 F139 K143 V146 Q150	W24 A70 I71 G79 V80 T81 W86 L93 I97 E102 V105 F140 K144 V147 Q151
BS06	J7Z	M	Y108 V111 S112 P120 E133 Y136 E137	Y109 V112 S113 P121 E134 Y137 E138

Gene Ontology

Molecular Function

• GO:0016168 chlorophyll binding

Cellular Component

• GO:0030076 light-harvesting complex

External links

• PDB: RCSB:3iiu, PDBe:3iiu, PDBj:3iiu
• PDBsum: 3iiu
• PubMed: 19934052
• UniProt: P80484|PCP1_AMPCA Peridinin-chlorophyll a-binding protein 1, chloroplastic