Structure of PDB 3dtr Chain M

Receptor sequence

>3dtrM (length=298) Species: 1063 (Cereibacter sphaeroides)

NIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGS
LGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYGLS
FAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAI
WLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNPFHGL
SIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRW
TMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQNHG

3D structure

• PDB: 3dtr Restoring proton transfer in L212Q mutant of photosynthetic reaction center
• Chain: M
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	F197 G203 I206 A207 Y210 L214	F193 G199 I202 A203 Y206 L210
BS02	BPH	M	Y210 L214 M218 W252	Y206 L210 M214 W248
BS03	BCL	M	H182 L183	H178 L179
BS04	BCL	M	M122 T186 N187 L196 F197 H202 S205 I206 Y210 G280 I284	M118 T182 N183 L192 F193 H198 S201 I202 Y206 G276 I280
BS05	BPH	M	G63 F67 W129 A149 F150	G59 F63 W125 A145 F146
BS06	FE	M	H219 E234 H266	H215 E230 H262
BS07	U10	M	M218 H219 T222 A248 A249 W252 M256 N259 A260 I265 W268	M214 H215 T218 A244 A245 W248 M252 N255 A256 I261 W264
BS08	SPN	M	F67 F68 I70 W75 W115 S119 W157 G161 F162 H182	F63 F64 I66 W71 W111 S115 W153 G157 F158 H178

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:3dtr, PDBe:3dtr, PDBj:3dtr
• PDBsum: 3dtr
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)