Structure of PDB 3dsy Chain M

Receptor sequence

>3dsyM (length=302) Species: 1063 (Cereibacter sphaeroides)

AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPI
YLGSLGVLSLFSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPE
YGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAF
LSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSLVHGNLFYNP
FHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAAL
FWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN
HG

3D structure

• PDB: 3dsy Restoring Proton transfer in L212Q mutant of photosynthetic reaction center
• Chain: M
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	M	F197 G203 I206 A207 Y210 L214	F197 G203 I206 A207 Y210 L214
BS02	BPH	M	Y210 L214 M218 W252	Y210 L214 M218 W252
BS03	FE	M	H219 E234 H266	H219 E234 H266
BS04	BCL	M	H182 L183	H182 L183
BS05	BCL	M	M122 T186 N187 L196 F197 H202 S205 I206 Y210 G280 I284	M122 T186 N187 L196 F197 H202 S205 I206 Y210 G280 I284
BS06	BPH	M	G63 F67 W129 A149 F150	G63 F67 W129 A149 F150
BS07	U10	M	M218 H219 T222 A248 A249 W252 M256 N259 A260 I265 W268	M218 H219 T222 A248 A249 W252 M256 N259 A260 I265 W268
BS08	SPN	M	F67 F68 I70 W75 W115 S119 W157 G161 F162 H182	F67 F68 I70 W75 W115 S119 W157 G161 F162 H182

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:3dsy, PDBe:3dsy, PDBj:3dsy
• PDBsum: 3dsy
• UniProt: P0C0Y9|RCEM_CERSP Reaction center protein M chain (Gene Name=pufM)